DailyChanges » Wix.com » 07/13/2013

WIX.COM - Name server Changes on 2013-07-13

Now displaying nameserver activity for wix.com for the date of July 13, 2013. To find the most recent nameserver activity, view recent activity for wix.com or perform a new search.

Name server Management

Review historical hosting & historical Whois records for wix.com at DomainTools.com.

Monday

Newly Registered Domain Names on WIX.COM

Currently displaying 967 of 967 domain names registered on July 13, 2013 and hosted at at the nameserver wix.com.
Domain Name
16bitband.com
1bottleentertainment.com
2020filmvision.com
2050art-factory.com
2050artfactory.com
413sportproductions.com
5pmarketingdigital.com
6scontracts.com
aakyaa.com
aaronalvarezdanceandart.com
aarosol.com
abeautystorynailbar.com
ablccc.com
abscoaching.com
absolutebarstaffing.com
accesoriosvosbijoux.com
acentoaccesorios.com
acmhc-fl.org
acorpszen.com
activoadventures.com
actu-rm.com
adamandkira.com
adbanns.com
adelaideremedialtherapy.com
adhmag.net
adrianratcliffeart.com
advocacialagoa.com
advogadapaula.com
agenciabuzz.com
agilsites.com
ahipotecaria.com
aidedomicile92.com
alanjacksonsolotribute.com
alatransportes.com
albaritfc.com
albertoescalera.com
alfajormardelplata.com
alihodzicamra.com
alishajoy.com
allamericanlock.net
alleganystateparkcamping.com
allinklusivetattoo.com
allorapidedepannage.com
allstarsocceracademyflorida.com
allthingsfb.com
allyshahamber.net
amadobrigadeiro.com
amandasteelman.com
amcupcaketoppers.com
americancowhorsecompany.com
amydelcarmen.com
amykreitals.com
an-ale.org
angelaleon.com
anthonymariobruno.com
antoniobaldaiatopografia.com
aphrodite-escort.net
apocalipsky.com
appointments4u.net
aquarelleetpastel.com
ar8producciones.com
arqts.com
art-molot.com
art-t-studio.com
artedabeleza.net
artisans-paca.com
artofencampment.com
asbeecorporation.com
assaflan.com
assisiprogettogiovani.org
assured-emergency-power.com
asylumjapan.com
ataboxing.com
ateamelectronics.com
atelier2bconcept.com
atmosfera-interior.com
atouchofeuroperemodeling.com
atriadesigns.com
augustothefevers.com
aurumhifi.com
autoesthetique.com
autofoxes.com
avcseguridad.com
b-team.biz
backtocubacafe.com
bailaconmigo60.com
ballerinadream.net
bancocred.com
bandmastersuk.com
barbwiretv.com
barbyoungpdx.com
bayshoreadvisorsinc.com
bbomplatina.com
bbpantheonroma.com
beanhubtrading.com
beartownmaplesyrup.com
bedesigns.biz
befitcustomcykler.com
begamaquinaria.com
bellenoellephotography.com
ben-fern.com
benedict-quito.com
bensonartbox.com
bergerinnovations.com
berlinapartmentdeals.com
bessharrington.com
bettystrip.com
beyondfoas.com
bhopestudio.com
bibolicious.com
bichozen.com
bioenergeia.com
biscaynebeacheast.com
biscuiteartes.com
blueeyedbabyphotography.com
bmtmobili.com
boarendaextra.com
bobenterprises.net
bodegafamiliazamperoni.com
bodytransformations.net
bombayyogi.com
bookheartpublishing.com
brainbalancepgh.com
brancadesalto.com
brazilianwaxmurrieta.com
breitschuh.info
briansuh03.com
brickhousesocialclub.com
bringinghomeband.com
brituncooked.com
browniedocadu.com
bubbletea-ukraine.com
buckwheatpillowsrus.com
buffetvintage.net
bustersdrivein.com
byamcullens.com
cabanayachtparty.com
caldeirapavan.com
calicluboutlet.com
candy-sweet.com
cansusakiz.com
capannonekingkong.com
cardinalmarketinggroup.net
cardscanbenton.org
carissavaughn.com
carldorvilphotography.com
carlgagnoncpa.com
carmelstonesupply.net
carolinagomezdesign.com
carpetsteamcleaninggnss.com
carriacourental.com
carvalho-representacoes.com
carvebeta.com
cashandstaff.com
cavallinodesign.com
cazamomentos.com
ccranking.com
center-of-healing.com
centralfireservices.com
centroeurodent.com
centrofamiliaeduca.com
cerrajeriaenvalencia.net
cestrutural.com
cesydney.org
chadgoodrichres.com
chasepetergarrettson.com
chaumontinteriors.com
chrisb-photography.com
christoferaven.com
christopherkirkpatrickclarinet.com
christourkingpreschool.com
chrisundflo.com
chrysomakariou.com
churchcreekconstruction.com
ciaocsnvendas.com
cimaqsa.com
cjchemicals.org
cleanwaterproj.org
click-mcghee.com
clinicadeolhosarrudamello.com
clubdomusamerica.com
clyffe-pypard.com
cmajorporter.com
coaching-unterengadin.com
coavabookingandproduction.com
cocks-rotisserie.com
colleenandpat.com
college-fix.com
comfortableman2013.com
committobefitnc.com
comunidadeecvv.com
comunidadvidaplena.com
consultoriaacademica.com
controlthechaos.net
cookinclub.org
coolabahwines.com
copamexicovan.com
coquinaassistedliving.com
coralceudaboca.com
corpansuz.com
corporate-meals.com
corporesanoacademia.net
corridaobsb.com
cortonuncajamas.com
coryconradartist.com
cosmocateringnz.com
cosmonails.net
courtesyconsulting.com
cozinhaviva.info
cpf-gw.com
craigstevenphillips.com
cream-official.com
crediaco.com
crosspointeacademyfortmyers.org
crystalrealtyghana.com
csassociates.biz
csbham.com
cunger.com
customjiva.com
cutiefloops.com
cwfyoungmarines.com
cyndylawrence.com
dallasinstantgs.com
dan-artecomasmaos.com
danielacooney.com
danielthaetedesign.com
dapxphotos.com
darajaqitts.com
daveandgenaregettingmarried.com
davecrawfordimages.com
davidthelaughman.com
decrevintagecustom.com
deejayharley.com
delned.com
deltasigumd.org
denaliexecutives.com
designfactorymaroc.com
diarrheathon.com
dietcareuk.com
direcciondemarca.com
djmariferrari.com
djviniciuslima.com
dlgparties.com
dmcicondosheridantowers.com
downonmainsteet.com
downonmainstreetky.com
dra-uk.org
drawing-pencil.net
dreamingofdecor.com
drevo-roda.com
drmayurkhairnar.com
ducerevolver.biz
ducttapeanddynamite.com
dwepressurewashing.biz
e-curriculum.biz
ecdesignloft.com
ecos5.com
eduevando.com
edugomesdesigner.com
eiffel-events.com
electrokaskad.biz
eletrodiesel.net
eliteimagem.com
ellendefockert.com
elliteestudio.com
elonnevo.com
emiliemazier-naturoquebec.com
eminentiarealestate.com
emiratesgoldexchange.com
emmamstudio.com
energo-resurs.org
enredandola9.com
enriquemasso.com
epiphanybyrose.com
equipemultigold.com
erfotografo.com
erikburdett.com
ernotauriainen.com
erstdiemilchgallery.com
esalterations.com
espacepur3.com
espacodocorpo.biz
espacosidarta.com
essentialshaircare.com
eszzie-design.com
eternodoce.com
etltt.com
etnagreenpark.com
euindicoeventos.com
everydaybeauty.biz
everythingdrjay.com
evsildaefabio.com
exclusive-mma.com
exsoexsocute.com
extasynightclub.com
extendhairsd.com
ezadzsavingsmagazine.net
facefactorstudio.com
fadingsunday.com
faiconsultora.com
farm-affair.com
fasscinaenlinea.com
felisavelascophotography.com
femaleobsession.net
fenlandairporttransfers.com
ferramentabrunelli.com
ferreirapires.com
festaboombox.com
festbird.com
festivitalocacao.com
fireball40.org
firstclasscarsrental.com
fitfabfemme.com
fitforlifeinspiration.com
fitnessbyava.com
fivestartintoreria.com
flexruger.com
florenciacisneros.com
floridahomes4cash.com
flowerjaguar.com
flyhighmmusic.com
focustutorials.com
fonzofotografia.com
foxtaleproduction.com
frankfurt-2014.com
frankienorthbondi.com
frederickassociatescontractsales.com
fredericmelanson.com
frikyspace.com
fuckstreetgodirt.com
fullliferock.com
fun-betaffiliates.com
fun-gaming.net
funaffiliates.com
fussionstar.com
gabardinecouture.com
gardinensalada.com
garywestby.com
gcapinsurance.com
geekriotshop.com
gekbooks.com
genevacreative.com
gentutopia.com
geo-otchet.com
gesslien.com
gifenglish.com
giftsbychristy.com
gigaripple.com
giuliasantarellifoto.com
giunjiengenharia.com
glasgowsbiggesttickets.com
globaluniversity-ro.com
glowprofessionalmakeup.com
goldmanaero.com
goner.biz
gosports.biz
goushistorygo.com
governancementor.com
grammarfoundationschool.com
grandvalleywinetours.com
gretchenneer.com
groceryto.com
grothresumes.com
groundworkinteriors.com
guilhermeteixeiraeventos.com
guitarsav.com
habeshaweddingrental.com
hakkiteam.com
halfsignum.com
hampshire-hogroast.org
hanachoi.com
hanktaylorphoto1.com
hansenpropriadades.com
haulindyjunk.com
hayatmusic.com
hcccustoms.com
healthperformancelab.com
helliearts.com
help-artem.info
hensongroupllc.com
hhs30yearreunion.com
hideawayharbormarine.com
hollatimeproductions.com
hollywoodstylez.net
homenscongregacionais.com
hospedajeseconomicos.com
hotchicksrule.org
hotelsts.com
hotfootpressing.com
hotmodels2013.com
hovaspan.com
howsweetcouture.com
hungrybootie.com
hycalifornia.com
hydrotecnica.net
hyperionprod.com
iacanga.net
iambraw.com
iamkingdombeauty.com
iclub-teambuild.com
iddocconsultoria.com
ideas-frison.com
ideasforgold.com
iftbtattoogallery.com
ignitefashions.net
ikeyiashanee.com
ilciliegiobiorito.net
ilciliegiofiorito.net
ilhanozer.org
imalpr.com
imperiodanumismatica.com
impossiblecampaign.com
indigenousgovernment.org
indovedosing.com
inesmaximino.com
inforclever.com
innerpeacecommunity.com
innervy.com
innovasesores.com
inoui-gd.com
intactneuro.com
inustheytrust.com
invisiblelinemusic.com
irenexzhu.com
irentabit.com
j1movers.com
jacquesandluluwedding.com
jadegreenmarketingsolutions.com
jadethegoatstudios.com
jaeparkjae.com
jamisonkaron.com
janineeversart.com
jazqdope.com
jed-con.com
jeffhardestybooks.com
jeffhaydenjr.com
jenniferlkania.com
jennifermosherphotography.net
jeremydrewconsultancy.com
jerseyconstruction.biz
jerusalemviolinist.net
jiahuahe.com
jjassessoriapublica.com
jlangenderfer2015.com
joannekimberlyphotography.com
johnathansigalas.com
jonathanrussellmacarthur.com
jonsonwellnesscompany.com
jorgehirmas.com
jracessoriacontabil.com
julien-wolf-automotive-photography.com
juliensordetto.com
jumpingjackparties.com
juneaurookardwedding.com
junkyardbeer.com
justwrightwebdesign.com
k-officiel.com
kamizoto.com
kanatakitchens.com
kapua-salon.com
katydidphotography.net
kaylamichellephotography.biz
kdassing.com
kentcorvettes.com
kerrilynnshellhornpresskit.com
khalidconsultant.com
kinocamp.com
kixx.biz
konceitedkreations.com
kopicoffeeroasting.com
kravmagahalmstad.com
kriselliottphoto.org
krushcancer.com
kryzanovsky.com
ks-decisive-battle.com
ksadagula.com
ksrenergyservices.com
kylieandlynette.com
lahairmakeup.com
lakanyajacobs.com
landbergdesigns.com
landbergsdesigns.com
lapassiondelacreation.com
laraklaus.com
larissabalg.com
laskinnyamor.com
latiendadelhabano.net
leanforwardcoaching.com
leap-usa.com
leebradesigns.com
lejardinagile.com
leospasazs.com
lesfrancsarchersdechimay.com
lessandmorecollective.com
letskpoptour.com
lexlingroup.com
lfelipec.com
lifeandhopeforialomita.com
lifetranstionservices.biz
lillianapassalacqua.com
lioric.com
lisacarter.info
lizcortez.org
lkrphoto.com
lodges-in-pretoria.com
lojafotospaco.com
lookingglasstattoos.com
looli.biz
lordmeppershall.com
lorenaamkie.com
losbailestestsite.com
lospaseoskindergarten.com
lotoswellness.com
louiesbox.biz
lpabuffalo.com
luisbustamante.org
lupitaariasmakeup.com
luptbrasil.com
m4mykonos.com
macillust.com
mademoisellejanellesutton.com
maggieboggs.com
magicenergyradio.com
makenziecheer.com
makeupbyjenna.com
makeyourcityguide.com
manangkhasilapenrith.com
manassestransportes.com
mandjcorporation.com
manolinbooks.com
manolofotostyle.com
maomaophotography.com
maraudernews.com
mariacontreras.net
marianohenestrosaportraits.com
marinavial.com
marquespaulaengenharia.com
marshellindo.com
marthasmexicanrestaurantwestoverhills.com
massaslaromana.com
massimilianomassimi.com
materialised3d.com
mateservice.org
matheusmarx.com
mattscript.com
maungihall.com
mayer-music.com
mbtreinamentos.com
mbwdesigns.com
me2usolutions.org
medtorinc.com
meettheshivelys.com
meganrowley.com
megaphotoevideo.com
melbournedarwintransport.com
mercurypublicrelations.com
metodovertesana.com
michaelgaryford.com
michelbedin.com
michellescaferoc.com
mikefriisfotograf.com
mikekorpi.com
mikesfriendlydeliveryservices.com
million-est.net
miltonandco.com
mimiitsme.com
minceur33.com
minceurbordeaux.com
minceurgironde.com
mirgor.net
misfigurasdemache.com
missaoeam.com
mitadelmundo.com
mitorerim.com
mk7japan.net
mobilityfirst.net
moderno-pers.com
moffettproductions.com
momschips.biz
momsoe.com
mongaguamusical.com
monicalayton.com
monsieurjim.com
moonlitpathtothesoul.com
motovitrin.com
mountainmovingministries.com
moutainmovingministries.com
moveright-in.info
movingganaacpforward.org
mrhydebow.com
mtfamilycreations.com
multicolchoesipatinga.com
multicolours.biz
musaboat.com
musicaparaimagenes.com
musicfactoryeventos.com
mymainstreetmyboston.org
myoptics.net
myprincess.biz
myshopperinparis.com
nabevsystems.com
nanancompany.com
nathanfernandes.com
nathangrant-showjumper.com
natphotog.com
naturalbodybuildingmm.com
nauticalcreations.biz
nawarti.com
newmystonela.com
nextonetattoo.com
nextworldmuzik.com
nicolasteeuwen.com
nightcreateddesign.com
niwotacupuncturespot.com
niyachampaneria.com
northunionmusic.info
nouvelleinternational.com
nvarquitetura.com
oakbsocial.com
oakstagram.com
oberlinphoenix.org
obliterateprocrastination.info
ocean5boutique.com
oceanprideship.com
ocsillc.com
oekoumenearchitecture.com
ofcmode.com
officialdaytonallen.com
oilandart.com
olympuseries.com
one-day-a-quote.com
onecupcakeatatime.org
operationstorybook.org
orlovkatour.com
ourbadscience.com
outerbeautyblowdrybar.com
outfitpt2013.com
oxdaweb.com
pablomagee.com
pablotrejes.com
paixaocatalogos.com
pal-trotting.com
pamellatanimura.com
pamperhouse.biz
panikoproductions.com
pape-pizza.com
par-agraphe.com
passerwilson.com
paulcglaze.com
pawguaranteed.com
paymeformywork.biz
peekabootattoo.com
penaareiaperuibe.com
peninsulatransportassist.org
pennjerseyea.org
pennjerseyeducationalliance.org
perezroofinginc.com
perfectbpo.com
personalisedlove.com
personalizevc.com
pescadorrigs.com
peterainsworth.net
phgelinas.net
phoenixcontractorswisconsin.com
phormamentismexico.com
photographe-champagne-ardenne.com
photoliciousoutside.com
pineirotranslations.com
pinellashomes4cash.com
pixelsbymarta.com
plasticosheresi.com
playboydrinkopportunity.com
pleasure-party.net
pocket-professionals.com
pops-art.com
portfoliobrito.com
powerogere.com
pretechnologies.com
prettypetiteshop.com
prichoska.com
producoesanaearthur.com
profilesofexcellencecare.com
psychicrivers.com
psytriedinstvo.com
publimarkvca.com
pugsandpaws.com
pwphotoandpaint.com
qiqyou.com
quovatus7.com
raadvocaciacriminal.com
radiiimagination.com
radioactiveads.com
rafatoledo.com
raidalfaraj.com
raidalfraraj.com
rainbowterrazzo.com
ramindustrialsupply.com
ramonaartandwinefest.net
rankoras.com
rasehorse.com
raulceballosvo.com
rayaskreativas.com
rccgdominionchapel.com
realaversana2010.com
reapersrealmnc.com
red36ent.com
redessantos.com
reflexologieplantaire.biz
reginamjohnson.com
remediesbyjr.net
renacerlibre.com
rent-a-bart.com
rentacardalmatia.com
reporteclic.com
resgateanjos.com
residencialchiloe.com
restoemcasa.com
revisioncosmedic.com
revistalifestyletattoo.com
rfhomeservices.com
rhenndo.com
richbuyshouses.com
ride-art.com
rikki-photographer.com
rimonartgallery.com
rinnail.com
ripplingeffectmx.com
ritesforall.org
roandrachel.com
rodkinter.com
rosarioaguirre.com
rosettelove.com
ross-bisbee.com
rotaractapucarana.org
roy-reuveny.com
royaldynastystudios.com
royalontologies.org
rscmini.com
rtdiaz.com
rubenwestspeaks.com
rudecoracoeseeventos.com
rugbydiscos.com
rxsmartcap.net
saintritasodality.com
salembrooklyn.com
salgadosfamilia.com
salonfoux.com
samech-tantra.com
samediagnosticsport.com
sandiegolodgingcommission.com
santainkclothing.com
sarahmajor.info
sarahmwong.com
savethecowboy.org
sbdwlongboardshop.com
sbmglobaldata.com
sbvas.net
schoneslicht.com
sebastian-fuchsberger.com
sekretdeneg.info
sergeymorar.com
serralheriaedesign.com
sevengungames.com
sgbrandnewlaunches.com
sglifestyles.com
shalitproductions.com
shannonmurphyportfolio.com
sharozzay.com
shebydee.com
sheehan-enterprises.com
shinki-support.net
shopdancerealness.com
shopindigene.com
shotinthedarkfw.com
showroom-sainte-anne.com
sibphotography.net
silverhillphotoinstruction.com
sixbellsproductions.com
sizzlingsalsaenglewoodbergencounty.com
skynner.org
sliceofheavenstanton.com
slowdowntown.net
smd-dds.biz
smithhousephoto.com
smmunicorte.com
sobrietythroughoutpatient.org
soccerworldscorpions.com
sofin.biz
softwatersa.com
solardocosme.com
solorioforsenate.com
solucaoassistenciatecnica.com
somethingpublic.com
somillennial.com
sosconsulting-llc.com
sourirbybasmahbakhrebah.com
southeastidahoattorney.com
sparklemixx.com
sparklewithmia.com
spittalfielddogcareperth.com
spreiwaterproofnafia.com
sprinklesandflour.com
stamp-kaliningrad.com
staracademylv.com
startupstoryboard.com
starwise.org
stat2e.com
stavlivne.com
staywfo.com
stephenwalkeractor.com
stevearmstrongartist.com
stonesparroworganics.com
stopatthegamingshop.com
stropuva.biz
structureoflove.com
studiofdimage.com
stylerotang.com
sufficientlystudios.com
sunnivalentine.com
superitienda.com
superlistadeemail.com
survivalhardwarellc.com
sutyls.com
swiftandboldsecurity.com
swishing.info
sylanneemariages91.com
taimalfalasi.com
talentoscariri.com
tankionline-shop.com
taraz-arena.com
tarickvillegas.com
tatankaknives.com
taximercedeshondarribia.com
taxreturns247.com
tcc-techconsult.com
teambows.com
techsol-panama.com
teddytzeng.com
tees-tees.com
terapiacuradaalma.com
teresastevenson.com
terracareservices.com
texaswatersafety.com
teyprobackup.com
tfasiashop.com
tgcrepublicanparty.com
thaniyay-terapiasalternativas.com
the-perfect-details.com
the-zew.com
thebeautifulgame.biz
thedirtywebseries.com
thefaughts.com
thelittleexplorersclub.com
thelordshealingcenter.com
themassmovement.com
themichelingrocer.com
themindfullivingroom.com
theoceanmanorinns.com
theoshunlife.com
thepgmgroup.com
theragmen.com
therapybythasja.com
theriverwalkproperties.com
thesportsutopia.com
thevegancanteen.com
thewriterlyway.com
tidyorganizing.com
timlee2002.com
tintingpaint.com
titirinoia.com
tktrassa.com
tlcouriers.net
tnctiling.com
tomepperson.net
tonpereira.com
tonytecnollogia.com
topcoloradoagent.com
tpaequipamentos.com
traktor-rockfest.com
trancegrezor.net
transparenciacoyotepec.com
transparenthedgefund.com
trevinomusic.com
trevorandmarly.com
tri-astral.com
trialofag.com
tribedashiki.com
tribolambecoco.com
trimthatbush.net
trinityfutures.com
trustpropertysearchsingapore.com
tsauw.com
tver-dragon.com
twistedtulipok.com
typesetter-invest.com
typicalz.com
u-store24.com
ubezpieczenia-pastuszek.com
udoschmidt-art.com
ugg-cleaners.com
uniquemainevations.com
universitehayatin.com
unodostresajugar.com
updateddesign.com
upstatecyclingandfitness.com
urbmt.com
vaastudesign.net
valeriayjorge.com
vallezzdesign.com
vanitycurvesboutique.com
vaporelectronicodf.com
vcconstrutora.com
vegasdb.com
veggeasy.com
venuphairmakeup.com
verdantgray.com
verghina-samos.com
veterinariavalparaiso.com
viclimpa.com
vidaenmovimiento.org
vieirasportcar.com
vigoremember.com
villa-mia.biz
villaagnestaroudant.com
villachezshell.com
vinpress.com
vitalityspatreartments.com
vivieti.com
voicestudiolondon.com
vok-ing.com
voleiosports.com
vosges-chalet-prestige.com
voterachelgloriosodooley.com
w-danshaku.com
wagglemiami.com
watchungplaza.com
wearetheheard.com
weaverfinchsb.com
webuyhousesrockford.com
weldermex.org
wem-mobiles.com
wemmobiles.com
wesleyiporti.com
whisperedmag.com
wigimedya.com
wildroserunraiser.org
windmkt.com
wingapinc.com
woodysalessalem.net
wordupjamz.com
work-4-all.org
worldgatedistribution.com
xn--90ahabmrpccfc3byetc.com
xtremeenergyinflatables.com
yankeeheatingandcoolingnj.com
yanydesignz.com
yatinandsima.com
yellowexchange.com
yesbrisbane.com
yield-capital.com
yogapathllc.com
youmustfocus.com
yournewslettersolution.com
zakisushi.com
zerowastemx.com
zlmedia-montana.com
zpchips.biz
Name server / Domain Name Ownership: Whois Search
Tell us a nameserver, domain name or IP address and we'll tell you all about its ownership.