KOBILINE.COM

Now displaying nameserver activity for kobiline.com for the date of February 11, 2016.

Name server History

The domain kobiline.com was registered on May 14, 2001, and we have nameserver history going back to June 23, 2005. It is listed as a nameserver for 2,811 domains and is listed as the primary nameserver for 2,811 domains, including:

Name server Management

The domain owner for kobiline.com is listed as Koc Net Haberlesme Teknolojileri ve Iletisim Hizme, which is associated with 711 domains.

Use Reverse WHOIS to find all domain names owned by this domain name owner.

Review historical hosting & historical Whois records for kobiline.com at DomainTools.com.

Get the complete list of all 2,811 domain names hosted on kobiline.com

The Name server for the domain KOBILINE.COM is VODAFONE.NET.TR.

Name server Hosts

The Name server kobiline.com uses 2 unique addresses to provide its service. You can find information for all of these below.

  • NS2.KOBILINE.COM
  • IP Address
    Location
    Turkey
    Managed By
    Vodafone Net Iletisim Hizmetleri Anonim Sirketi
    Domains
    2,811
  • NS1.KOBILINE.COM
  • IP Address
    Location
    Turkey
    Managed By
    Vodafone Net Iletisim Hizmetleri Anonim Sirketi
    Domains
    2,809
Monday

Domain Names Transferred Out of KOBILINE.COM

Currently displaying 50 of 571 domain names transferred away from kobiline.com on February 11, 2016.
Domain Name Transferred To
4leventarcelikyetkiliservisi.com name-services.com
abidinpasaarcelikyetkiliservisi.com name-services.com
acibademarcelikyetkiliservisi.com name-services.com
acipayamarcelikyetkiliservisi.com name-services.com
adanafatiharcelikyetkiliservisi.com name-services.com
adanaguzelyaliarcelikyetkiliservisi.com name-services.com
adanakurtulusarcelikyetkiliservisi.com name-services.com
adapazariciracilararcelikyetkiliservisi.com name-services.com
adapazaricumhuriyetarcelikyetkiliservisi.com name-services.com
adapazariyenicamiarcelikyetkiliservisi.com name-services.com
adapazariyenidoganarcelikyetkiliservisi.com name-services.com
adiyaman56evlerarcelikyetkiliservisi.com name-services.com
adiyamanturgutreisarcelikyetkiliservisi.com name-services.com
adiyamanvilayetarcelikyetkiliservisi.com name-services.com
afsinarcelikyetkiliservisi.com name-services.com
afyonarcelikyetkiliservisi.com name-services.com
agriarcelikyetkiliservisi.com name-services.com
akcaabatarcelikyetkiliservisi.com name-services.com
akcakocaarcelikyetkiliservisi.com name-services.com
akhisararcelikyetkiliservisi.com name-services.com
aksarayarcelikyetkiliservisi.com name-services.com
aksarayihlaraarcelikyetkiliservisi.com name-services.com
aksehirarcelikyetkiliservisi.com name-services.com
aksekiarcelikyetkiliservisi.com name-services.com
akyaziarcelikyetkiliservisi.com name-services.com
alanyajandarmaarcelikyetkiliservisi.com name-services.com
alanyasarayarcelikyetkiliservisi.com name-services.com
alasehirarcelikyetkiliservisi.com name-services.com
aliagaarcelikyetkiliservisi.com name-services.com
alsancakarcelikyetkiliservisi.com name-services.com
altinozuarcelikyetkiliservisi.com name-services.com
altintepearcelikyetkiliservisi.com name-services.com
amasya1arcelikyetkiliservisi.com name-services.com
amasya2arcelikyetkiliservisi.com name-services.com
anamurarcelikyetkiliservisi.com name-services.com
ankaracebeciarcelikyetkiliservisi.com name-services.com
ankaragolbasiarcelikyetkiliservisi.com name-services.com
ankarahaskoyarcelikyetkiliservisi.com name-services.com
antakyabulvararcelikyetkiliservisi.com name-services.com
antakyakanatliarcelikyetkiliservisi.com name-services.com
antalyacalliarcelikyetkiliservisi.com name-services.com
antalyadogugarajiarcelikyetkiliservisi.com name-services.com
antalyadokumaarcelikyetkiliservisi.com name-services.com
antalyagullukarcelikyetkiliservisi.com name-services.com
antalyakonyaaltiarcelikyetkiliservisi.com name-services.com
antalyamemurevleriarcelikyetkiliservisi.com name-services.com
antalyamevlanaarcelikyetkiliservisi.com name-services.com
antalyazerdalilikarcelikyetkiliservisi.com name-services.com
arakliarcelikyetkiliservisi.com name-services.com
arapgirarcelikyetkiliservisi.com name-services.com
Name server / Domain Name Ownership: Whois Search
Tell us a nameserver, domain name or IP address and we'll tell you all about its ownership.