DailyChanges » Justhost.com » 02/21/2013

JUSTHOST.COM - Name server Changes on 2013-02-21

Now displaying nameserver activity for justhost.com for the date of February 21, 2013. To find the most recent nameserver activity, view recent activity for justhost.com or perform a new search.

Name server Management

Review historical hosting & historical Whois records for justhost.com at DomainTools.com.

Monday

Newly Registered Domain Names on JUSTHOST.COM

Currently displaying 402 of 402 domain names registered on February 21, 2013 and hosted at at the nameserver justhost.com.
Domain Name
12pcshats.com
24haat.com
24haat.net
2ry.us
78green4green.com
aasait.com
aautooftexas.com
abbottyping.com
accutrialhungary.com
acraftyteacher.com
activerealtymi.com
advantagemf.com
aeras-ensemble.com
affordablerenovating.com
ahdivasstyle.com
albertaroof.net
alexanderthegr8est.com
allcladslowcookers.com
allpolish.com
alrayanboat.com
alwayskerala.com
amelie6.com
amenalleluia.org
americaworx.org
analogbird.com
andreigoea.com
arcmagazine.org
argumentfallacy.com
artistiqueinspirations.com
baltimore-chiropractic.com
baltimoretrips.com
bargainbrothers.org
basortutokasi.org
bathfire.com
bauspm.com
baykusfilmyapim.com
bayoubabiesworld.com
beerbliss.com
bestharlemshakeonline.com
bestrussianwomen.com
bethanysongs.com
bigisolutionsllc.com
bingojim.com
bitcointrustgroup.org
blaxbergfamilychiropractic.com
bluemedpharma.com
boobporn.org
boobstv.org
boobsvid.org
booksusedandnew.com
breakingparalleldesigns.com
breastporn.org
bro-stats.com
bucksstairtreads.com
cambridgecrayfish.com
cameratuners.com
cancerresearchinfos.com
cancervivekc.org
caregiveraustin.com
carloscarbonfiber.com
cassidywalkerphotography.com
catchnhellfishing.com
cclist.org
cefenterprisesinc.com
cepolin.com
chaoticcoutureclothing.com
charlesauer.net
charlottefitnessproducts.com
cheapdivorce.biz
chilledsmiley.com
christiandanielarcher.com
clanepstein.com
clanng.com
cmcculloughcounseling.com
colinhovila.com
cook-cookpainting.com
copperinvestments.info
coralspringsfop.org
coventryaerials.net
cp901.com
creoendesairys.com
croydexuk.com
dabbleandstitch.com
dacsan24h.net
daikofabrics.com
darmoweaukcje.com
dastarkhwaan.com
davemckayphotography.com
davidknowles.biz
deltaoneinc.net
designedbyduke.com
designmcn.com
dhnart.com
diasporaentrepreneurs.com
diasporaentrepreneurship.com
distance-learning-college.org
djaloe.biz
dkrelectricalconsulting.com
dlyavas.net
donadonico.com
dorsalabs.com
dronetechllc.com
e-smartmart.com
eabp100.com
eabp90.com
eaguins.us
earthbinder.net
elegantdecorinc.com
eleganthomedecorgroup.com
enjoybookshop.com
equilibrioensalud.com
esarptokasi.org
esukmean.com
europbusiness.com
eurosompharma.com
evernotetricks.com
experts-area.com
extraordinaryaloevera.com
fastelegantfloors.com
fccchulavista.org
fccollision.com
feiyong119.com
flowlabusa.com
forthemiddleclass.com
foxgloveweddingphotography.com
frackane.com
freepastlife.org
friendsofhamas.org
fschenuligmyfernbsaav.com
furnexstore.com
furnishedrentalyorkville.com
futurityinvestments.com
gamerenvy.com
gdhi.org
gencashx.com
getacomfortkit.com
getitboyzent.com
ginkowine.com
goldenstatesurfaces.com
goproprint.net
grannygoodnesshealth.com
gratisporrfilm24.com
grazeworks.com
greenrawgoddess.com
greenwaldgroop.com
gromulsonfacebook.com
grupoincoe.com
hairregrowing.net
healthandbeautyforeverreview.com
healthyskinantiwrinklecreamreviews.com
helpkostihelpindia.com
highplainsgordonsetters.com
hilalgfx.com
hiphopjewelrystores.com
hkjiabei.com
hostaleloasis.com
hotrussiangirls.net
hotrussianmen.net
hotwildpepper.com
housekeepinglondon.org
huanrananewlook.com
hugeboob.org
hugebreasts.org
husky-sy.com
hystairea.com
iklantiptop.com
iknowbucks.com
inapictures.com
interventicasa.com
iphatours.com
ipi-edu.us
ishegod.com
isthais.com
jamboshow.net
jeffdunne.com
jenniferholzman.com
jiabeielec.com
jillianlaw.com
jmcompany.biz
joncheneypiano.com
josephesturo.com
jusanditravels.com
justineking.com
kitchendesignfl.com
kmemail29.com
ktc88ems.com
kupwpolsce.com
lakehousewares.com
lamedisciple.us
latcomltd.com
lavocazione.org
learck12mathonline.com
learndutchonline.us
legendsbrewpub.com
letitbk1.com
lider56.com
lindadimeffphd.com
lingzhimushroomshop.com
linkedugroup.com
lol43.com
londonbridgestation.com
loveforhischildren.com
lppmszb2013.com
maggroups.com
mahisfashions.com
mamporn.org
mannydeluna.info
marcswalker.com
mariopascual.com
massivebreasts.org
masteringstrategicrisk.com
maxsaveruk.com
may-jewelry.com
mcspics.com
mebelifines.com
meditationdeutschland.com
mendedheartsgiftcollection.com
mendedheartsgiftcollection.net
micahsplumbing.com
michaeldimitry.com
midsouthexpress.com
miltonsenadeeraeyewitness.com
misrpharma.com
mobil1vs.com
mobiledevicesandchargers.com
modularpanelindo.com
moicalex.com
moneymakervn.org
monocacyinteriordesign.com
moonridertherapy.org
mrsmoneymaker.net
mtsnowy.com
muymcom.com
mybabybeluga.com
mybid2win.com
mybigbadbuick.com
mybigbadbuicks.com
mycomfortkit.com
myjcexpress.com
mymcc.net
myphotonow.com
myteammaya.com
n4css.com
naturesmagicgift.com
netkov.com
netkov.net
newharlemshake.com
newmediapost.com
newportchristadelphians.com
nextgenqr.com
ninjamedia.net
nirankarmediaworks.com
nochg.com
nochrge.com
nordmob.com
nsamg.com
nsp-online.net
nutelespiritudelanoche.com
nwugc.com
oaklandkofc.org
oddam.net
ofertasenpisos.com
omanandaom.com
openeworld.com
openpitblasting.net
palaciodejoyas.com
panshulglobal.net
parrisdesigns.com
partygetaways.com
pcfixgib.com
pelicanlegal.com
persigas.com
philterfree.com
pikesvillechiropractor.com
pixarwpthemes.com
polishdating.biz
polskiesklepy.net
popularaluminium.com
practiceck12mathonline.com
prcastyelx.com
printonlineshop.com
projectjb.org
psfaccounting.com
pumpkincarvingfun.com
pumpkincarvingfun.net
purrfectsite.com
puwatch.com
qaportal.us
quackingthemes.com
quantica-bg.com
quanticabg.com
ravivaldiyaphotography.com
recedinghairlines.org
recycleitenv.com
redbridgegardencenter.com
reparentingmodel.com
rescuingrylie.com
responsivefix.com
richiscool.com
riveramlaw.com
rochomefinders.com
rolwaipahu.net
roseashtest.com
roverescue.com
roverescuegame.com
royalpolytechnic.org
rpgglory.com
ruddquarterhorses.com
russiansexymen.com
russianwodka.net
ryanheartsjess.com
rynekautuzywanych.com
sa-consultancy.org
sahagiandesign.com
saleleadsgenerator.info
saltokasi.org
samsungs4galaxy.com
sateofmotorcycles.com
sbsltduk.com
selwayfarm.com
seocopywriterlondon.com
servicios-en-linea.com
sevencreation.com
sexsyrussianteens.com
sexyrussianboys.com
sexyrussianguys.com
sexyrussianlady.com
sexyrussianmen.com
sgmailrank.net
sgrho-centralohio.com
shivajyoti.com
showluvgetlove.com
shyrpa.com
sky7-deco.com
skytelsv.com
smartsurveillancesolutions.com
sncareer.com
socialchameli.com
solaceinfotech.com
solarpanelsandinverters.com
somewhere-in-time-online.com
somewhere-in-time-online.net
sporminderleri.com
springmaintenance.com
stephanstudios.com
successremix.com
suncitydeals.com
supportshah.com
surajfoundation.org
swahilishow.com
syracusesoundbeammusicservices.com
szbmlpp2013.com
taihoawedding.com
taiwattpad.org
tammiesmalls.com
tandblekningdirekt.com
teaminfographics.net
techdynamix.com
tecshopbrasil.com
teemo-w.com
theaterlove.com
thebuschallenge.com
thecomfortkit.com
thefreedomshelter.org
thegoddamngallows.com
thejohnnydeppimpersonator.com
thelast5kilos.com
theplumbingphysician.com
theshimlaw.com
thewannabebanker.com
theygetpaidtosaythis.com
timraynelaw.com
transportemagiadelsur.com
traumareparenting.com
traumareparentingmodel.com
travel2albania.info
treat-tastic.com
ugaguitar.com
uk-google-checkout.com
unbridledual.com
undefinableevents.com
uniquejdm.com
usguitartec.com
uzywaneauta.net
venturepanda.com
vitoldtravel.com
waitingtoloseweight.com
westparkaquatics.com
whatismarijuana.org
whizzyaudio.com
wholesalescarvesff.com
wholesaleshoesc.com
whytoronto.org
wigocn.com
womanporn.org
worldbestharlemshake.com
worldwidewaterbottledwater.com
wowgol.net
xmindcash.com
xtranscash.com
yeetel.com
yoganea.com
Name server / Domain Name Ownership: Whois Search
Tell us a nameserver, domain name or IP address and we'll tell you all about its ownership.